PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN39316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 352aa    MW: 39554.4 Da    PI: 6.2214
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN39316.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
       KHN39316.1 14 RGLWSPEEDEKLINYITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding50.64.4e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE  l+++++  lG++ W+ Ia++++ gRt++++k++w+
       KHN39316.1  67 RGSFSPEEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.315961IPR017930Myb domain
SuperFamilySSF466898.99E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.57E-121761No hitNo description
PROSITE profilePS5129426.04662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2565116IPR009057Homeodomain-like
SMARTSM007173.4E-1666114IPR001005SANT/Myb domain
PfamPF002498.5E-1567110IPR001005SANT/Myb domain
CDDcd001674.57E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPEEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLLSHD  120
VIPSLATFSD FHSPGNIGSM ESLFPFTANP NVILNFHHHT DQLYLPTTPS SIPQGFDHIN  180
NDVKLDINNY NANNFLHIQN IPTPEIVLPS SNDPSSYNDT WSLDCVALHL NPNQENQITK  240
SDDTTLHYVV DKFINPMVLQ QYEGPLVEPI VPKVSKSIED YVCSIPYSST SQEQHEATTT  300
KFQCYPEDLT VAANQLEYVD AFMSSLPSST TSSSASSNQI VSNLIIPSGW EP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-79AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583007.10.0PREDICTED: transcription factor MYB26
TrEMBLA0A0B2RXZ90.0A0A0B2RXZ9_GLYSO; Transcription factor MYB86
STRINGGLYMA07G01050.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.21e-81myb domain protein 26
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]